PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016436499.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 483aa    MW: 55151.6 Da    PI: 10.5678
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016436499.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.84.9e-081147138
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlk 38
                     +++W t+E+++l  av+++G+++W+ +a+++   Rt +
   XP_016436499.1 11 KMNWGTWEELILGGAVRRHGTRDWNVVASELR-ARTVY 47
                     689****************************9.99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-41045IPR009057Homeodomain-like
PfamPF002492.2E-61145IPR001005SANT/Myb domain
CDDcd001670.005861357No hitNo description
SuperFamilySSF473706.93E-18243358IPR001487Bromodomain
SMARTSM002972.9E-16254358IPR001487Bromodomain
Gene3DG3DSA:1.20.920.103.6E-16257378IPR001487Bromodomain
PfamPF004392.0E-10263342IPR001487Bromodomain
PROSITE profilePS5001410.498269339IPR001487Bromodomain
CDDcd043696.47E-15270353No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MEGEMDVGPR KMNWGTWEEL ILGGAVRRHG TRDWNVVASE LRARTVYPYC FTPEACRTSA  60
WFEELRKRRV EELKRELERS ESSIGFLESK IESLKAEREQ SDQIDYGLSR TESPAPPTKS  120
EDIESFVKDE AKDGLSAGSF TLDIRTNQSP ESQVPTIPLT DVKLERSESC ERDKVPSTSK  180
VTEASNGNGG AVRKRRGKRR RKDAVWDAKE GSIEESDNVC STSLASTSHC KEALTSCEHS  240
IRHSPVNDHR GGLSRFRNDD LMRIFTSITL HEAAMVFRHR LDSQKRARYK KMIRRHMDIE  300
TVKSRLASWS IKTPGELFRD FLLLANNAMV FYSKRTREYK AAMALRDIVT RAYRQHYKGS  360
YYKATSSLLP FPTIGNPPGK PRSVRPRPSK DKLQAKYGNN VKDNIAGKLG RQNHRPGDAD  420
SKVPLQSWLS AKKGFKRPGK IKRGPILESV NPQVKESTQH NIKVKEDHRI KPVTKERKRA  480
RQK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1194202RRGKRRRKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016436499.10.0PREDICTED: uncharacterized protein LOC107762639 isoform X2
TrEMBLK4B9A50.0K4B9A5_SOLLC; Uncharacterized protein
STRINGSolyc02g078810.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42150.18e-14DNA-binding bromodomain-containing protein